PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007400P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 85aa    MW: 9865.66 Da    PI: 11.9675
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007400P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.83.9e-312877251
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                    prlrWtp+LH++Fv+ave+LGG+e+AtPk +l++m+v+gLt++hvkSHLQ
  MELO3C007400P1 28 PRLRWTPDLHRCFVHAVERLGGEERATPKMVLQIMNVNGLTISHVKSHLQ 77
                    8************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.3632484IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-292477IPR009057Homeodomain-like
SuperFamilySSF466891.38E-142678IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-232878IPR006447Myb domain, plants
PfamPF002497.0E-82977IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MRVSRQRVFH DINFKSPMVR PYVRSKMPRL RWTPDLHRCF VHAVERLGGE ERATPKMVLQ  60
IMNVNGLTIS HVKSHLQVQI GSFL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818757e-81LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132627e-81LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439998.14e-52PREDICTED: probable transcription factor KAN2 isoform X1
SwissprotQ700D97e-29MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A0A0KHB71e-51A0A0A0KHB7_CUCSA; Uncharacterized protein
STRINGVIT_00s1624g00010.t012e-38(Vitis vinifera)
STRINGGLYMA09G00685.11e-37(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93812840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.12e-32G2-like family protein